UBTD1 (NM_024954) Human Mass Spec Standard
CAT#: PH303403
UBTD1 MS Standard C13 and N15-labeled recombinant protein (NP_079230)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203403 |
Predicted MW | 25.8 kDa |
Protein Sequence |
>RC203403 representing NM_024954
Red=Cloning site Green=Tags(s) MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE PPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ KDFVIQVIINQPPPPQD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079230 |
RefSeq Size | 1575 |
RefSeq ORF | 681 |
Synonyms | FLJ11807 |
Locus ID | 80019 |
UniProt ID | Q9HAC8 |
Cytogenetics | 10q24.1-q24.2 |
Summary | The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. [provided by RefSeq, Mar 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410953 | UBTD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410953 | Transient overexpression lysate of ubiquitin domain containing 1 (UBTD1) |
USD 396.00 |
|
TP303403 | Recombinant protein of human ubiquitin domain containing 1 (UBTD1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review