UBTD1 (NM_024954) Human Mass Spec Standard

CAT#: PH303403

UBTD1 MS Standard C13 and N15-labeled recombinant protein (NP_079230)

Product Images

Coomassie blue staining of purified UBTD1 protein (Cat# TP303403). The protein was produced from HEK293T cells transfected with UBTD1 cDNA clone (Cat# RC203403) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203403
• Predicted MW: 25.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203403 representing NM_024954
  Red=Cloning site Green=Tags(s)
  
  MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDA
  LKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPE
  PPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQ
  KDFVIQVIINQPPPPQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079230
• RefSeq Size: 1575
• RefSeq ORF: 681
• Synonyms: FLJ11807
• Locus ID: 80019
• UniProt ID: Q9HAC8
• Cytogenetics: 10q24.1-q24.2
• Summary: The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. [provided by RefSeq, Mar 2014]
• Protein Families: Druggable Genome