Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal UBTD1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBTD1. |
Rabbit Polyclonal Antibody against UBTD1 (C-term G195)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This UBTD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 180-212 amino acids from the C-terminal region of human UBTD1. |
UBTD1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Recombinant protein from human UBTD1 |
Rabbit Polyclonal Anti-UBTD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBTD1 antibody: synthetic peptide directed towards the middle region of human UBTD1. Synthetic peptide located within the following region: TEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHA |
Rabbit Polyclonal Anti-UBTD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human UBTD1 |
Ubtd1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- UBTD1