Destrin (DSTN) (NM_006870) Human Mass Spec Standard
CAT#: PH303419
DSTN MS Standard C13 and N15-labeled recombinant protein (NP_006861)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203419 |
| Predicted MW | 18.5 kDa |
| Protein Sequence |
>RC203419 protein sequence
Red=Cloning site Green=Tags(s) MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP EDLNRACIAEKLGGSLIVAFEGCPV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006861 |
| RefSeq Size | 1614 |
| RefSeq ORF | 495 |
| Synonyms | ACTDP; ADF; bA462D18.2; HEL32 |
| Locus ID | 11034 |
| UniProt ID | P60981, V9HWA6 |
| Cytogenetics | 20p12.1 |
| Summary | The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402051 | DSTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423272 | DSTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402051 | Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 1 |
USD 436.00 |
|
| LY423272 | Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 2 |
USD 436.00 |
|
| TP303419 | Recombinant protein of human destrin (actin depolymerizing factor) (DSTN), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China