NUDT6 (NM_007083) Human Mass Spec Standard

CAT#: PH303470

NUDT6 MS Standard C13 and N15-labeled recombinant protein (NP_009014)

Product Images

Coomassie blue staining of purified NUDT6 protein (Cat# TP303470). The protein was produced from HEK293T cells transfected with NUDT6 cDNA clone (Cat# RC203470) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203470
• Predicted MW: 35.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203470 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLD
  AAAFQKGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYA
  SHQVGVAGAVFDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQ
  QHTNPGAFGKSDMYIICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFD
  KIDLTVEELPAVYTGLFYKLYHKELPENYKTMKGID
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009014
• RefSeq Size: 1197
• RefSeq ORF: 948
• Synonyms: ASFGF2; FGF-AS; FGF2AS; GFG-1; GFG1
• Locus ID: 11162
• UniProt ID: P53370
• Cytogenetics: 4q28.1
• Summary: This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may regulate FGF2 expression. This gene has also been shown to have hormone-regulatory and antiproliferative actions in the pituitary that are independent of FGF2 expression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]