MAD1 (MAD1L1) (NM_003550) Human Mass Spec Standard
CAT#: PH303471
MAD1L1 MS Standard C13 and N15-labeled recombinant protein (NP_003541)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203471 |
Predicted MW | 83.1 kDa |
Protein Sequence |
>RC203471 protein sequence
Red=Cloning site Green=Tags(s) MEDLGENTMVLSTLRSLNNFISQRVEGGSGLDISTSAPGSLQMQYQQSMQLEERAEQIRSKSHLIQVERE KMQMELSHKRARVELERAASTSARNYEREVDRNQELLTRIRQLQEREAGAEEKMQEQLERNRQCQQNLDA ASKRLREKEDSLAQAGETINALKGRISELQWSVMDQEMRVKRLESEKQELQEQLDLQHKKCQEANQKIQE LQASQEARADHEQQIKDLEQKLSLQEQDAAIVKNMKSELVRLPRLERELKQLREESAHLREMRETNGLLQ EELEGLQRKLGRQEKMQETLVGLELENERLLAKLQSWERLDQTMGLSIRTPEDLSRFVVELQQRELALKD KNSAVTSSARGLEKARQQLQEELRQVSGQLLEERKKRETHEALARRLQKRVLLLTKERDGMRAILGSYDS ELTPAEYSPQLTRRMREAEDMVQKVHSHSAEMEAQLSQALEELGGQKQRADMLEMELKMLKSQSSSAEQS FLFSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLRED HSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFR KACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSI PAFLSSLTLELFSRQTVA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003541 |
RefSeq Size | 2754 |
RefSeq ORF | 2154 |
Synonyms | MAD1; PIG9; TP53I9; TXBP181 |
Locus ID | 8379 |
UniProt ID | Q9Y6D9 |
Cytogenetics | 7p22.3 |
Summary | MAD1L1 is a component of the mitotic spindle-assembly checkpoint that prevents the onset of anaphase until all chromosome are properly aligned at the metaphase plate. MAD1L1 functions as a homodimer and interacts with MAD2L1. MAD1L1 may play a role in cell cycle control and tumor suppression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401184 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423037 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC423038 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425354 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425355 | MAD1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY401184 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 1 |
USD 396.00 |
|
LY423037 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2 |
USD 605.00 |
|
LY423038 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 3 |
USD 605.00 |
|
LY425354 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2 |
USD 605.00 |
|
LY425355 | Transient overexpression lysate of MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 3 |
USD 605.00 |
|
PH322718 | MAD1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001013858) |
USD 2,055.00 |
|
TP303471 | Recombinant protein of human MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 1 |
USD 867.00 |
|
TP322718 | Recombinant protein of human MAD1 mitotic arrest deficient-like 1 (yeast) (MAD1L1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review