TAGLN2 (NM_003564) Human Mass Spec Standard

CAT#: PH303473

TAGLN2 MS Standard C13 and N15-labeled recombinant protein (NP_003555)

Product Images

Coomassie blue staining of purified TAGLN2 protein (Cat# TP303473). The protein was produced from HEK293T cells transfected with TAGLN2 cDNA clone (Cat# RC203473) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203473
• Predicted MW: 22.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203473 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANRGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINALY
  PEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARD
  DGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003555
• RefSeq Size: 1419
• RefSeq ORF: 597
• Synonyms: HA1756
• Locus ID: 8407
• UniProt ID: P37802, A0A384MTL2
• Cytogenetics: 1q23.2
• Summary: The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2013]