Phosphatidic acid phosphatase type 2B (PLPP3) (NM_003713) Human Mass Spec Standard

CAT#: PH303480

PPAP2B MS Standard C13 and N15-labeled recombinant protein (NP_003704)

Product Images

Coomassie blue staining of purified PLPP3 protein (Cat# TP303480). The protein was produced from HEK293T cells transfected with PLPP3 cDNA clone (Cat# RC203480) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203480
• Predicted MW: 35.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203480 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCND
  ESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAIS
  QSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYL
  VLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKT
  KMTLSLPAPAIRKEILSPVDIIDRNNHHNMM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003704
• RefSeq Size: 3324
• RefSeq ORF: 933
• Synonyms: Dri42; LPP3; PAP2B; PPAP2B; VCIP
• Locus ID: 8613
• UniProt ID: O14495
• Cytogenetics: 1p32.2
• Summary: The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Ether lipid metabolism, Fc gamma R-mediated phagocytosis, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Sphingolipid metabolism