CDC42EP1 (NM_007061) Human Mass Spec Standard

CAT#: PH303483

CDC42EP1 MS Standard C13 and N15-labeled recombinant protein (NP_008992)

Product Images

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203483
• Predicted MW: 39.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203483 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGS
  SGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSF
  DSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSEL
  LGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCP
  NGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEE
  WRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008992
• RefSeq Size: 2182
• RefSeq ORF: 1152
• Synonyms: 55 kDa bone marrow stromal/endothelial cell protein; BORG5; CDC42 effector protein (Rho GTPase binding) 1; CDC42 effector protein 1; CEP1; CEP1, BORG5, MSE55, MGC15316; MGC15316; MSE55; OTTHUMP00000028709; serum constituent protein
• Locus ID: 11135
• Cytogenetics: 22q13.1
• Summary: CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008]