CDC42EP1 (NM_007061) Human Recombinant Protein
CAT#: TP303483
Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203483 protein sequence
Red=Cloning site Green=Tags(s) MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGS SGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSF DSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSEL LGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCP NGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEE WRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008992 |
Locus ID | 11135 |
UniProt ID | Q00587 |
Cytogenetics | 22q13.1 |
Refseq Size | 2182 |
Refseq ORF | 1152 |
Synonyms | 55 kDa bone marrow stromal/endothelial cell protein; BORG5; CDC42 effector protein (Rho GTPase binding) 1; CDC42 effector protein 1; CEP1; CEP1, BORG5, MSE55, MGC15316; MGC15316; MSE55; OTTHUMP00000028709; serum constituent protein |
Summary | CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407674 | CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416226 | CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430215 | CDC42EP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY407674 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1) |
USD 325.00 |
|
LY416226 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1), transcript variant 2 |
USD 325.00 |
|
LY430215 | Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 1 (CDC42EP1) |
USD 325.00 |
|
PH303483 | CDC42EP1 MS Standard C13 and N15-labeled recombinant protein (NP_008992) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review