IRF1 (NM_002198) Human Mass Spec Standard

CAT#: PH303500

IRF1 MS Standard C13 and N15-labeled recombinant protein (NP_002189)

Product Images

Coomassie blue staining of purified IRF1 protein (Cat# TP303500). The protein was produced from HEK293T cells transfected with IRF1 cDNA clone (Cat# RC203500) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203500
• Predicted MW: 36.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203500 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEK
  EPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSC
  GDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLY
  NFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEI
  DSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002189
• RefSeq Size: 3567
• RefSeq ORF: 975
• Synonyms: IRF-1; MAR
• Locus ID: 3659
• UniProt ID: P10914, Q6FHN8
• Cytogenetics: 5q31.1
• Summary: 'The protein encoded by this gene is a transcriptional regulator and tumor suppressor, serving as an activator of genes involved in both innate and acquired immune responses. The encoded protein activates the transcription of genes involved in the body's response to viruses and bacteria, playing a role in cell proliferation, apoptosis, the immune response, and DNA damage response. This protein represses the transcription of several other genes. As a tumor suppressor, it both suppresses tumor cell growth and stimulates an immune response against tumor cells. Defects in this gene have been associated with gastric cancer, myelogenous leukemia, and lung cancer. [provided by RefSeq, Aug 2017]'
• Protein Families: Druggable Genome, Transcription Factors