Seladin 1 (DHCR24) (NM_014762) Human Mass Spec Standard

CAT#: PH303507

DHCR24 MS Standard C13 and N15-labeled recombinant protein (NP_055577)

Product Images

Coomassie blue staining of purified DHCR24 protein (Cat# TP303507). The protein was produced from HEK293T cells transfected with DHCR24 cDNA clone (Cat# RC203507) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203507
• Predicted MW: 60.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203507 representing NM_014762
  Red=Cloning site Green=Tags(s)
  
  MEPAVSLAVCALLFLLWVRLKGLEFVLIHQRWVFVCLFLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQR
  VRDIQKQVREWKEQGSKTFMCTGRPGWLTVSLRVGKYKKTHKNIMINLMDILEVDTKKQIVRVEPLVTMG
  QVTALLTSIGWTLPVLPELDDLTVGGLIMGTGIESSSHKYGLFQHICTAYELVLADGSFVRCTPSENSDL
  FYAVPWSCGTLGFLVAAEIRIIPAKKYVKLRFEPVRGLEAICAKFTHESQRQENHFVEGLLYSLDEAVIM
  TGVMTDEAEPSKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPI
  FRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQ
  PGLVHPKGNEAELYIDIGAYGEPRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREEFWEMFDGSLY
  HKLREKLGCQDAFPEVYDKICKAARH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055577
• RefSeq Size: 4286
• RefSeq ORF: 1548
• Synonyms: DCE; Nbla03646; seladin-1; SELADIN1
• Locus ID: 1718
• UniProt ID: Q15392
• Cytogenetics: 1p32.3
• Summary: 'This gene encodes a flavin adenine dinucleotide (FAD)-dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transmembrane
• Protein Pathways: Metabolic pathways, Steroid biosynthesis