FBXO31 (NM_024735) Human Mass Spec Standard

CAT#: PH303518

FBXO31 MS Standard C13 and N15-labeled recombinant protein (NP_079011)

Product Images

Coomassie blue staining of purified FBXO31 protein (Cat# TP303518). The protein was produced from HEK293T cells transfected with FBXO31 cDNA clone (Cat# RC203518) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203518
• Predicted MW: 41.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203518 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGR
  QEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSH
  GLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRERVRQEQQ
  EGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPVGV
  SSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAP
  SPQAFDEMLKNIQSLTS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079011
• RefSeq Size: 5990
• RefSeq ORF: 1101
• Synonyms: FBX14; Fbx31; FBXO14; MRT45; pp2386
• Locus ID: 79791
• UniProt ID: Q5XUX0
• Cytogenetics: 16q24.2
• Summary: This gene is a member of the F-box family. Members are classified into three classes according to the substrate interaction domain, FBW for WD40 repeats, FBL for leucing-rich repeats, and FBXO for other domains. This protein, classified into the last category because of the lack of a recognizable substrate binding domain, has been proposed to be a component of the SCF ubiquitination complex. It is thought to bind and recruit substrate for ubiquitination and degradation. This protein may have a role in regulating the cell cycle as well as dendrite growth and neuronal migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Protein Families: Druggable Genome