SERBP1 (NM_015640) Human Mass Spec Standard

CAT#: PH303582

SERBP1 MS Standard C13 and N15-labeled recombinant protein (NP_056455)

Product Images

Coomassie blue staining of purified SERBP1 protein (Cat# TP303582). The protein was produced from HEK293T cells transfected with SERBP1 cDNA clone (Cat# RC203582) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203582
• Predicted MW: 42.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203582 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQL
  RKESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEK
  PLEEKGEGGEFSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSGLKHEDKR
  GGSGSHNWGTVKDELTDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDR
  AKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRG
  GRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056455
• RefSeq Size: 6701
• RefSeq ORF: 1161
• Synonyms: CGI-55; CHD3IP; HABP4L; PAI-RBP1; PAIRBP1
• Locus ID: 26135
• UniProt ID: Q8NC51, Q5VU21, Q63HR1
• Cytogenetics: 1p31.3
• Summary: May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay. [UniProtKB/Swiss-Prot Function]