PELO (NM_015946) Human Mass Spec Standard

CAT#: PH303592

PELO MS Standard C13 and N15-labeled recombinant protein (NP_057030)

Product Images

Coomassie blue staining of purified PELO protein (Cat# TP303592). The protein was produced from HEK293T cells transfected with PELO cDNA clone (Cat# RC203592) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203592
• Predicted MW: 43.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203592 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVE
  AIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAV
  VMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASP
  GFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDD
  FYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH
  VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057030
• RefSeq Size: 2941
• RefSeq ORF: 1155
• Synonyms: CGI-17; PRO1770
• Locus ID: 53918
• UniProt ID: Q9BRX2
• Cytogenetics: 5q11.2
• Summary: This gene encodes a protein which contains a conserved nuclear localization signal. The encoded protein may have a role in spermatogenesis, cell cycle control, and in meiotic cell division. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome