BSCL2 (NM_032667) Human Mass Spec Standard

CAT#: PH303625

BSCL2 MS Standard C13 and N15-labeled recombinant protein (NP_116056)

Product Images

Coomassie blue staining of purified BSCL2 protein (Cat# TP303625). The protein was produced from HEK293T cells transfected with BSCL2 cDNA clone (Cat# RC203625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203625
• Predicted MW: 44.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203625 representing NM_032667
  Red=Cloning site Green=Tags(s)
  
  MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTVSHLSPVHFYY
  RTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRII
  STSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLEVELYADYRENSYVPTTGAIIEIHSKRIQLY
  GAYLRIHAHFTGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNS
  RKEVQRRISAHQPGAGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDG
  SGSWEDAALLTEANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_116056
• RefSeq Size: 1664
• RefSeq ORF: 1200
• Synonyms: GNG3LG; HMN5; PELD; SPG17
• Locus ID: 26580
• UniProt ID: Q96G97, A0A024R549
• Cytogenetics: 11q12.3
• Summary: This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2). [provided by RefSeq, Mar 2011]
• Protein Families: Druggable Genome, Transmembrane