BSCL2 (NM_032667) Human Recombinant Protein
CAT#: TP303625
Recombinant protein of human Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2
View other "BSCL2" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203625 representing NM_032667
Red=Cloning site Green=Tags(s) MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTVSHLSPVHFYY RTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRII STSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLEVELYADYRENSYVPTTGAIIEIHSKRIQLY GAYLRIHAHFTGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNS RKEVQRRISAHQPGAGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDG SGSWEDAALLTEANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116056 |
Locus ID | 26580 |
UniProt ID | Q96G97, A0A024R549 |
Cytogenetics | 11q12.3 |
Refseq Size | 1664 |
Refseq ORF | 1200 |
Synonyms | GNG3LG; HMN5; HMN5C; PELD; SPG17 |
Summary | This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2).[provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403190 | BSCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403190 | Transient overexpression lysate of Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2 |
USD 396.00 |
|
PH303625 | BSCL2 MS Standard C13 and N15-labeled recombinant protein (NP_116056) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review