PDRG1 (NM_030815) Human Mass Spec Standard

CAT#: PH303661

PDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_110442)

Product Images

Coomassie blue staining of purified PDRG1 protein (Cat# TP303661). The protein was produced from HEK293T cells transfected with PDRG1 cDNA clone (Cat# RC203661) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203661
• Predicted MW: 15.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203661 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPH
  PETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_110442
• RefSeq Size: 1384
• RefSeq ORF: 399
• Synonyms: C20orf126; PDRG
• Locus ID: 81572
• UniProt ID: Q9NUG6, A0A384NKN4
• Cytogenetics: 20q11.21
• Summary: May play a role in chaperone-mediated protein folding. [UniProtKB/Swiss-Prot Function]