FLAP (ALOX5AP) (NM_001629) Human Mass Spec Standard

CAT#: PH303785

ALOX5AP MS Standard C13 and N15-labeled recombinant protein (NP_001620)

Product Images

Coomassie blue staining of purified ALOX5AP protein (Cat# TP303785). The protein was produced from HEK293T cells transfected with ALOX5AP cDNA clone (Cat# RC203785) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203785
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203785 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAV
  LWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG
  SDFENYIKTISTTISPLLLIP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001620
• RefSeq Size: 921
• RefSeq ORF: 483
• Synonyms: FLAP
• Locus ID: 241
• UniProt ID: P20292
• Cytogenetics: 13q12.3
• Summary: This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Transmembrane