CHST10 (NM_004854) Human Mass Spec Standard

CAT#: PH303793

CHST10 MS Standard C13 and N15-labeled recombinant protein (NP_004845)

Product Images

Coomassie blue staining of purified CHST10 protein (Cat# TP303793). The protein was produced from HEK293T cells transfected with CHST10 cDNA clone (Cat# RC203793) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203793
• Predicted MW: 42.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203793 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKEL
  PDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIV
  LNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFE
  PWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVI
  GHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQK
  PDFLLN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004845
• RefSeq Size: 2872
• RefSeq ORF: 1068
• Synonyms: HNK-1ST; HNK1ST
• Locus ID: 9486
• UniProt ID: O43529
• Cytogenetics: 2q11.2
• Summary: This protein encoded by this gene transfers sulfate to the C-3 hydroxyl of terminal glucuronic acid of protein- and lipid-linked oligosaccharides. This protein was first identified as a sulfotransferase that acts on the human natural killer-1 (HNK-1) glycan; HNK-1 is a carbohydrate involved in neurodevelopment and synaptic plasticity. [provided by RefSeq, Feb 2011]
• Protein Families: Transmembrane