SIAH2 (NM_005067) Human Mass Spec Standard

CAT#: PH303802

SIAH2 MS Standard C13 and N15-labeled recombinant protein (NP_005058)

Product Images

Coomassie blue staining of purified SIAH2 protein (Cat# TP303802). The protein was produced from HEK293T cells transfected with SIAH2 cDNA clone (Cat# RC203802) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203802
• Predicted MW: 34.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203802 representing NM_005067
  Red=Cloning site Green=Tags(s)
  
  MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQ
  HHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKY
  ATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI
  NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATP
  RSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005058
• RefSeq Size: 2632
• RefSeq ORF: 972
• Synonyms: hSiah2
• Locus ID: 6478
• UniProt ID: O43255
• Cytogenetics: 3q25.1
• Summary: 'This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors