SIAH2 (NM_005067) Human Recombinant Protein

CAT#: TP303802

Recombinant protein of human seven in absentia homolog 2 (Drosophila) (SIAH2)

Product Images

Coomassie blue staining of purified SIAH2 protein (Cat# TP303802). The protein was produced from HEK293T cells transfected with SIAH2 cDNA clone (Cat# RC203802) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203802 representing NM_005067
  Red=Cloning site Green=Tags(s)
  
  MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQ
  HHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKY
  ATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDI
  NLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATP
  RSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005058
• Locus ID: 6478
• UniProt ID: O43255
• Cytogenetics: 3q25.1
• Refseq Size: 2632
• Refseq ORF: 972
• Synonyms: hSiah2
• Summary: This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors