HMGCL (NM_000191) Human Mass Spec Standard

CAT#: PH303817

HMGCL MS Standard C13 and N15-labeled recombinant protein (NP_000182)

Product Images

Coomassie blue staining of purified HMGCL protein (Cat# TP303817). The protein was produced from HEK293T cells transfected with HMGCL cDNA clone (Cat# RC203817) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203817
• Predicted MW: 34.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203817 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSV
  IETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNIN
  CSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGVGT
  PGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATED
  LVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000182
• RefSeq Size: 1617
• RefSeq ORF: 975
• Synonyms: HL
• Locus ID: 3155
• UniProt ID: P35914
• Cytogenetics: 1p36.11
• Summary: 'The protein encoded by this gene belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]'
• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine, leucine and isoleucine degradation