ROC2 (RNF7) (NM_014245) Human Mass Spec Standard

CAT#: PH303831

RNF7 MS Standard C13 and N15-labeled recombinant protein (NP_055060)

Product Images

Coomassie blue staining of purified RNF7 protein (Cat# TP303831). The protein was produced from HEK293T cells transfected with RNF7 cDNA clone (Cat# RC203831) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203831
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203831 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ
  EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055060
• RefSeq Size: 2010
• RefSeq ORF: 339
• Synonyms: CKBBP1; rbx2; ROC2; SAG
• Locus ID: 9616
• UniProt ID: Q9UBF6
• Cytogenetics: 3q23
• Summary: The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis