ROC2 (RNF7) (NM_014245) Human Recombinant Protein
CAT#: TP303831
Recombinant protein of human ring finger protein 7 (RNF7), transcript variant 1
View other "RNF7" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203831 protein sequence
Red=Cloning site Green=Tags(s) MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQ EDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055060 |
Locus ID | 9616 |
UniProt ID | Q9UBF6 |
Cytogenetics | 3q23 |
Refseq Size | 2010 |
Refseq ORF | 339 |
Synonyms | CKBBP1; rbx2; ROC2; SAG |
Summary | The protein encoded by this gene is a highly conserved ring finger protein. It is an essential subunit of SKP1-cullin/CDC53-F box protein ubiquitin ligases, which are a part of the protein degradation machinery important for cell cycle progression and signal transduction. This protein interacts with, and is a substrate of, casein kinase II (CSNK2A1/CKII). The phosphorylation of this protein by CSNK2A1 has been shown to promote the degradation of IkappaBalpha (CHUK/IKK-alpha/IKBKA) and p27Kip1(CDKN1B). Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402297 | RNF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402297 | Transient overexpression lysate of ring finger protein 7 (RNF7), transcript variant 1 |
USD 396.00 |
|
PH303831 | RNF7 MS Standard C13 and N15-labeled recombinant protein (NP_055060) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review