CALCOCO2 (NM_005831) Human Mass Spec Standard

CAT#: PH303843

CALCOCO2 MS Standard C13 and N15-labeled recombinant protein (NP_005822)

Product Images

Coomassie blue staining of purified CALCOCO2 protein (Cat# TP303843). The protein was produced from HEK293T cells transfected with CALCOCO2 cDNA clone (Cat# RC203843) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203843
• Predicted MW: 52.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203843 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY
  TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG
  EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL
  QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK
  KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG
  LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
  NCPICDKIFPATEKQIFEDHVFCHSL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005822
• RefSeq Size: 3682
• RefSeq ORF: 1338
• Synonyms: NDP52
• Locus ID: 10241
• UniProt ID: Q13137
• Cytogenetics: 17q21.32
• Summary: This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]