ARL11 (NM_138450) Human Mass Spec Standard
CAT#: PH303868
ARL11 MS Standard C13 and N15-labeled recombinant protein (NP_612459)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203868 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC203868 protein sequence
Red=Cloning site Green=Tags(s) MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL RASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_612459 |
RefSeq Size | 3760 |
RefSeq ORF | 588 |
Synonyms | ARLTS1 |
Locus ID | 115761 |
UniProt ID | Q969Q4 |
Cytogenetics | 13q14.2 |
Summary | This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408600 | ARL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408600 | Transient overexpression lysate of ADP-ribosylation factor-like 11 (ARL11) |
USD 325.00 |
|
TP303868 | Recombinant protein of human ADP-ribosylation factor-like 11 (ARL11) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review