ARL11 (NM_138450) Human Recombinant Protein
CAT#: TP303868
Recombinant protein of human ADP-ribosylation factor-like 11 (ARL11)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203868 protein sequence
Red=Cloning site Green=Tags(s) MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL RASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612459 |
Locus ID | 115761 |
UniProt ID | Q969Q4 |
Cytogenetics | 13q14.2 |
Refseq Size | 3760 |
Refseq ORF | 588 |
Synonyms | ARLTS1 |
Summary | This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408600 | ARL11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408600 | Transient overexpression lysate of ADP-ribosylation factor-like 11 (ARL11) |
USD 325.00 |
|
PH303868 | ARL11 MS Standard C13 and N15-labeled recombinant protein (NP_612459) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review