Stefin B (CSTB) (NM_000100) Human Mass Spec Standard

CAT#: PH303872

CSTB MS Standard C13 and N15-labeled recombinant protein (NP_000091)

Product Images

Coomassie blue staining of purified CSTB protein (Cat# TP303872). The protein was produced from HEK293T cells transfected with CSTB cDNA clone (Cat# RC203872) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203872
• Predicted MW: 11.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203872 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF
  QSLPHENKPLTLSNYQTNKAKHDELTYF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000091
• RefSeq Size: 940
• RefSeq ORF: 294
• Synonyms: CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD
• Locus ID: 1476
• UniProt ID: P04080, Q76LA1
• Cytogenetics: 21q22.3
• Summary: 'The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. [provided by RefSeq, Jul 2016]'