Aldolase (ALDOA) (NM_184041) Human Mass Spec Standard
CAT#: PH303900
ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908930)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203900 |
Predicted MW | 39.4 kDa |
Protein Sequence |
>RC203900 protein sequence
Red=Cloning site Green=Tags(s) MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_908930 |
RefSeq Size | 1597 |
RefSeq ORF | 1092 |
Synonyms | ALDA; GSD12; HEL-S-87p |
Locus ID | 226 |
UniProt ID | P04075, V9HWN7 |
Cytogenetics | 16p11.2 |
Summary | 'This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Sep 2017]' |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400006 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC405206 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC405207 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426825 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430669 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400006 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
USD 325.00 |
|
LY405206 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 |
USD 325.00 |
|
LY405207 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3 |
USD 325.00 |
|
LY426825 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4 |
USD 325.00 |
|
LY430669 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 |
USD 325.00 |
|
PH302576 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_000025) |
USD 2,055.00 |
|
PH303908 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908932) |
USD 2,055.00 |
|
PH325547 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_001121089) |
USD 2,055.00 |
|
TP302576 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
USD 823.00 |
|
TP303900 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 |
USD 823.00 |
|
TP303908 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3 |
USD 823.00 |
|
TP325547 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4 |
USD 748.00 |
|
TP720179 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review