ABHD11 (NM_148912) Human Mass Spec Standard
CAT#: PH303904
ABHD11 MS Standard C13 and N15-labeled recombinant protein (NP_683710)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203904 |
Predicted MW | 34.7 kDa |
Protein Sequence |
>RC203904 protein sequence
Red=Cloning site Green=Tags(s) MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_683710 |
RefSeq Size | 1467 |
RefSeq ORF | 945 |
Synonyms | PP1226; WBSCR21 |
Locus ID | 83451 |
UniProt ID | Q8NFV4 |
Cytogenetics | 7q11.23 |
Summary | This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407728 | ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430200 | ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407728 | Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 1 |
USD 396.00 |
|
LY430200 | Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 2 |
USD 396.00 |
|
TP303904 | Recombinant protein of human abhydrolase domain containing 11 (ABHD11), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review