ABHD11 (NM_148912) Human Recombinant Protein
CAT#: TP303904
Recombinant protein of human abhydrolase domain containing 11 (ABHD11), transcript variant 1
View other "ABHD11" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203904 protein sequence
Red=Cloning site Green=Tags(s) MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLLDGEAALPAVV FLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMSQDLQDLLPQLGLVPCVVVGH SMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATYVAAMRAINIADELPRSRARKLADEQLSSVI QDMAVRQHLLTNLVEVDGRFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIM RLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_683710 |
Locus ID | 83451 |
UniProt ID | Q8NFV4 |
Cytogenetics | 7q11.23 |
Refseq Size | 1467 |
Refseq ORF | 945 |
Synonyms | PP1226; WBSCR21 |
Summary | This gene encodes a protein containing an alpha/beta hydrolase fold domain. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq, Mar 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407728 | ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430200 | ABHD11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407728 | Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 1 |
USD 396.00 |
|
LY430200 | Transient overexpression lysate of abhydrolase domain containing 11 (ABHD11), transcript variant 2 |
USD 396.00 |
|
PH303904 | ABHD11 MS Standard C13 and N15-labeled recombinant protein (NP_683710) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review