Dynein (DYNLL2) (NM_080677) Human Mass Spec Standard
CAT#: PH303913
DYNLL2 MS Standard C13 and N15-labeled recombinant protein (NP_542408)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203913 |
Predicted MW | 10.3 kDa |
Protein Sequence |
>RC203913 protein sequence
Red=Cloning site Green=Tags(s) MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET KHFIYFYLGQVAILLFKSG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_542408 |
RefSeq Size | 1522 |
RefSeq ORF | 267 |
Synonyms | Dlc2; DNCL1B; RSPH22 |
Locus ID | 140735 |
UniProt ID | Q96FJ2 |
Cytogenetics | 17q22 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409101 | DYNLL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409101 | Transient overexpression lysate of dynein, light chain, LC8-type 2 (DYNLL2) |
USD 396.00 |
|
TP303913 | Recombinant protein of human dynein, light chain, LC8-type 2 (DYNLL2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review