MAX (NM_145114) Human Mass Spec Standard
CAT#: PH303944
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660089)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203944 |
| Predicted MW | 11.5 kDa |
| Protein Sequence |
>RC203944 protein sequence
Red=Cloning site Green=Tags(s) MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKLYFLFWKLCTPVL HRQSLMQKCHTFISSYQVHKKKECKI myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_660089 |
| RefSeq Size | 937 |
| RefSeq ORF | 288 |
| Synonyms | bHLHd4 |
| Locus ID | 4149 |
| UniProt ID | P61244 |
| Cytogenetics | 14q23.3 |
| Summary | 'The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]' |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | MAPK signaling pathway, Pathways in cancer, Small cell lung cancer |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408018 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408019 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408020 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408022 | MAX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY408018 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 2 |
USD 436.00 |
|
| LY408019 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 3 |
USD 436.00 |
|
| LY408020 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 4 |
USD 436.00 |
|
| LY408022 | Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 5 |
USD 436.00 |
|
| PH306294 | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660092) |
USD 2,055.00 |
|
| PH306812 | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660087) |
USD 2,055.00 |
|
| PH320343 | MAX MS Standard C13 and N15-labeled recombinant protein (NP_660088) |
USD 2,055.00 |
|
| TP303944 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 4 |
USD 823.00 |
|
| TP306294 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 5 |
USD 823.00 |
|
| TP306812 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 2 |
USD 823.00 |
|
| TP320343 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 3 |
USD 748.00 |
|
| TP720173 | Recombinant protein of human MYC associated factor X (MAX), transcript variant 1 |
USD 330.00 |
|
| TP761118 | Purified recombinant protein of Human MYC associated factor X (MAX), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China