WDR61 (NM_025234) Human Mass Spec Standard

CAT#: PH303963

WDR61 MS Standard C13 and N15-labeled recombinant protein (NP_079510)

Product Images

Coomassie blue staining of purified WDR61 protein (Cat# TP303963). The protein was produced from HEK293T cells transfected with WDR61 cDNA clone (Cat# RC203963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203963
• Predicted MW: 33.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203963 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSV
  DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKK
  EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD
  DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGV
  KYNGNGSKIVSVGDDQEIHIYDCPI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079510
• RefSeq Size: 1205
• RefSeq ORF: 915
• Synonyms: REC14; SKI8
• Locus ID: 80349
• UniProt ID: Q9GZS3
• Cytogenetics: 15q25.1
• Summary: WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]). [supplied by OMIM, Mar 2008]
• Protein Pathways: RNA degradation