CORO2A (NM_052820) Human Mass Spec Standard
CAT#: PH303993
CORO2A MS Standard C13 and N15-labeled recombinant protein (NP_438171)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203993 |
Predicted MW | 59.8 kDa |
Protein Sequence |
>RC203993 protein sequence
Red=Cloning site Green=Tags(s) MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGK LDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEW HPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPR AGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDA DTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLI EPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMA PASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQ QEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_438171 |
RefSeq Size | 5507 |
RefSeq ORF | 1575 |
Synonyms | CLIPINB; IR10; WDR2 |
Locus ID | 7464 |
UniProt ID | Q92828, A0A024R150, A8K9S3 |
Cytogenetics | 9q22.33 |
Summary | 'This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403258 | CORO2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418681 | CORO2A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403258 | Transient overexpression lysate of coronin, actin binding protein, 2A (CORO2A), transcript variant 2 |
USD 396.00 |
|
LY418681 | Transient overexpression lysate of coronin, actin binding protein, 2A (CORO2A), transcript variant 1 |
USD 396.00 |
|
PH300403 | CORO2A MS Standard C13 and N15-labeled recombinant protein (NP_003380) |
USD 2,055.00 |
|
TP300403 | Recombinant protein of human coronin, actin binding protein, 2A (CORO2A), transcript variant 1 |
USD 823.00 |
|
TP303993 | Recombinant protein of human coronin, actin binding protein, 2A (CORO2A), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review