SAT2 (NM_133491) Human Mass Spec Standard
CAT#: PH304044
SAT2 MS Standard C13 and N15-labeled recombinant protein (NP_597998)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204044 |
Predicted MW | 19.2 kDa |
Protein Sequence |
>RC204044 protein sequence
Red=Cloning site Green=Tags(s) MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY KALGAQDLTEAEGWHFFCFQGEATRKLAGK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_597998 |
RefSeq Size | 983 |
RefSeq ORF | 510 |
Synonyms | SSAT2 |
Locus ID | 112483 |
UniProt ID | Q96F10 |
Cytogenetics | 17p13.1 |
Summary | Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine. [UniProtKB/Swiss-Prot Function] |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408821 | SAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408821 | Transient overexpression lysate of spermidine/spermine N1-acetyltransferase family member 2 (SAT2) |
USD 325.00 |
|
TP304044 | Recombinant protein of human spermidine/spermine N1-acetyltransferase family member 2 (SAT2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review