CD99 (NM_002414) Human Mass Spec Standard

CAT#: PH304056

CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405)

Product Images

Coomassie blue staining of purified CD99 protein (Cat# TP304056). The protein was produced from HEK293T cells transfected with CD99 cDNA clone (Cat# RC204056) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204056
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204056 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP
  NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG
  AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002405
• RefSeq Size: 1255
• RefSeq ORF: 555
• Synonyms: HBA71; MIC2; MIC2X; MIC2Y; MSK5X
• Locus ID: 4267
• UniProt ID: P14209
• Cytogenetics: X;Y
• Summary: 'The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration