CD99 (NM_002414) Human Mass Spec Standard
CAT#: PH304056
CD99 MS Standard C13 and N15-labeled recombinant protein (NP_002405)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204056 |
| Predicted MW | 18.8 kDa |
| Protein Sequence |
>RC204056 protein sequence
Red=Cloning site Green=Tags(s) MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPP NPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAG AISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002405 |
| RefSeq Size | 1255 |
| RefSeq ORF | 555 |
| Synonyms | HBA71; MIC2; MIC2X; MIC2Y; MSK5X |
| Locus ID | 4267 |
| UniProt ID | P14209 |
| Cytogenetics | X;Y |
| Summary | 'The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016]' |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400863 | CD99 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426583 | CD99 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400863 | Transient overexpression lysate of CD99 molecule (CD99), transcript variant 1 |
USD 436.00 |
|
| LY426583 | Transient overexpression lysate of CD99 molecule (CD99), transcript variant 2 |
USD 436.00 |
|
| TP304056 | Purified recombinant protein of Homo sapiens CD99 molecule (CD99), transcript variant 1 |
USD 823.00 |
|
| TP720374 | Recombinant protein of human CD99 molecule (CD99), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China