TAZ (WWTR1) (NM_015472) Human Mass Spec Standard
CAT#: PH304082
WWTR1 MS Standard C13 and N15-labeled recombinant protein (NP_056287)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204082 |
| Predicted MW | 44.1 kDa |
| Protein Sequence |
>RC204082 protein sequence
Red=Cloning site Green=Tags(s) MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_056287 |
| RefSeq Size | 5135 |
| RefSeq ORF | 1200 |
| Synonyms | TAZ |
| Locus ID | 25937 |
| UniProt ID | Q9GZV5 |
| Cytogenetics | 3q25.1 |
| Summary | Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. Regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition. [UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414524 | WWTR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LC433001 | WWTR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY414524 | Transient overexpression lysate of WW domain containing transcription regulator 1 (WWTR1), transcript variant 1 |
USD 436.00 |
|
| LY433001 | Transient overexpression lysate of WW domain containing transcription regulator 1 (WWTR1), transcript variant 2 |
USD 436.00 |
|
| TP304082 | Recombinant protein of human WW domain containing transcription regulator 1 (WWTR1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China