TEM8 (ANTXR1) (NM_018153) Human Mass Spec Standard
CAT#: PH304112
ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_060623)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204112 |
| Predicted MW | 37.1 kDa |
| Protein Sequence |
>RC204112 protein sequence
Red=Cloning site Green=Tags(s) MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLA HKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYR TASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQG IIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLL CPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSLHKIASGPTTAACME myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_060623 |
| RefSeq Size | 2360 |
| RefSeq ORF | 999 |
| Synonyms | ATR; GAPO; TEM8 |
| Locus ID | 84168 |
| UniProt ID | Q9H6X2, Q96EC6 |
| Cytogenetics | 2p13.3 |
| Summary | This gene encodes a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. The encoded protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409333 | ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC413252 | ANTXR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY409333 | Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 2 |
USD 436.00 |
|
| LY413252 | Transient overexpression lysate of anthrax toxin receptor 1 (ANTXR1), transcript variant 3 |
USD 436.00 |
|
| PH318473 | ANTXR1 MS Standard C13 and N15-labeled recombinant protein (NP_444262) |
USD 2,055.00 |
|
| TP304112 | Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 3 |
USD 439.00 |
|
| TP318473 | Recombinant protein of human anthrax toxin receptor 1 (ANTXR1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China