HIPPI (IFT57) (NM_018010) Human Mass Spec Standard

CAT#: PH304116

IFT57 MS Standard C13 and N15-labeled recombinant protein (NP_060480)

Product Images

Coomassie blue staining of purified IFT57 protein (Cat# TP304116). The protein was produced from HEK293T cells transfected with IFT57 cDNA clone (Cat# RC204116) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204116
• Predicted MW: 49.1 kDa
• Protein Sequence:
  Sequence Link

  >RC204116 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPS
  RHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGY
  GEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLNV
  LKAQTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALK
  ETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVM
  EELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV
  IPEPATGFY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060480
• RefSeq Size: 3223
• RefSeq ORF: 1287
• Synonyms: ESRRBL1; HIPPI; MHS4R2; OFD18
• Locus ID: 55081
• UniProt ID: Q9NWB7
• Cytogenetics: 3q13.12-q13.13
• Summary: Required for the formation of cilia. Plays an indirect role in sonic hedgehog signaling, cilia being required for all activity of the hedgehog pathway (By similarity). Has pro-apoptotic function via its interaction with HIP1, leading to recruit caspase-8 (CASP8) and trigger apoptosis. Has the ability to bind DNA sequence motif 5'-AAAGACATG-3' present in the promoter of caspase genes such as CASP1, CASP8 and CASP10, suggesting that it may act as a transcription regulator; however the relevance of such function remains unclear. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Huntington's disease