Arg 3.1 (ARC) (NM_015193) Human Mass Spec Standard

CAT#: PH304129

ARC MS Standard C13 and N15-labeled recombinant protein (NP_056008)

Product Images

Coomassie blue staining of purified ARC protein (Cat# TP304129). The protein was produced from HEK293T cells transfected with ARC cDNA clone (Cat# RC204129) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204129
• Predicted MW: 45.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204129 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERELKGLHRSVGK
  LESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRLESTGGKYPVG
  SESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVD
  TQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS
  REAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQ
  RGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056008
• RefSeq Size: 2948
• RefSeq ORF: 1188
• Synonyms: Arg3.1; hArc
• Locus ID: 23237
• UniProt ID: Q7LC44
• Cytogenetics: 8q24.3
• Summary: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors (By similarity). Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. [UniProtKB/Swiss-Prot Function]