Bone marrow stromal cell antigen 1 (BST1) (NM_004334) Human Mass Spec Standard
CAT#: PH304151
BST1 MS Standard C13 and N15-labeled recombinant protein (NP_004325)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204151 |
Predicted MW | 35.7 kDa |
Protein Sequence |
>RC204151 protein sequence
Red=Cloning site Green=Tags(s) MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004325 |
RefSeq Size | 1497 |
RefSeq ORF | 954 |
Synonyms | CD157 |
Locus ID | 683 |
UniProt ID | Q10588 |
Cytogenetics | 4p15.32 |
Summary | 'Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq, Jul 2008]' |
Protein Families | Transmembrane |
Protein Pathways | Calcium signaling pathway, Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418052 | BST1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418052 | Transient overexpression lysate of bone marrow stromal cell antigen 1 (BST1) |
USD 325.00 |
|
TP304151 | Recombinant protein of human bone marrow stromal cell antigen 1 (BST1) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review