Bone marrow stromal cell antigen 1 (BST1) (NM_004334) Human Mass Spec Standard

CAT#: PH304151

BST1 MS Standard C13 and N15-labeled recombinant protein (NP_004325)

Product Images

Coomassie blue staining of purified BST1 protein (Cat# TP304151). The protein was produced from HEK293T cells transfected with BST1 cDNA clone (Cat# RC204151) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204151
• Predicted MW: 35.7 kDa
• Protein Sequence:
  Sequence Link

  >RC204151 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI
  WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF
  LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE
  IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC
  ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004325
• RefSeq Size: 1497
• RefSeq ORF: 954
• Synonyms: CD157
• Locus ID: 683
• UniProt ID: Q10588
• Cytogenetics: 4p15.32
• Summary: 'Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq, Jul 2008]'
• Protein Families: Transmembrane
• Protein Pathways: Calcium signaling pathway, Metabolic pathways, Nicotinate and nicotinamide metabolism