Superoxide Dismutase 3 (SOD3) (NM_003102) Human Mass Spec Standard

CAT#: PH304156

SOD3 MS Standard C13 and N15-labeled recombinant protein (NP_003093)

Product Images

Coomassie blue staining of purified SOD3 protein (Cat# TP304156). The protein was produced from HEK293T cells transfected with SOD3 cDNA clone (Cat# RC204156) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204156
• Predicted MW: 25.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204156 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSAT
  LDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHP
  QHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVV
  GVCGPGLWERQAREHSERKKRRRESECKAA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003093
• RefSeq Size: 1546
• RefSeq ORF: 720
• Synonyms: EC-SOD
• Locus ID: 6649
• UniProt ID: P08294, A0A140VJU8
• Cytogenetics: 4p15.2
• Summary: 'This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the conversion of superoxide radicals into hydrogen peroxide and oxygen, which may protect the brain, lungs, and other tissues from oxidative stress. Proteolytic processing of the encoded protein results in the formation of two distinct homotetramers that differ in their ability to interact with the extracellular matrix (ECM). Homotetramers consisting of the intact protein, or type C subunit, exhibit high affinity for heparin and are anchored to the ECM. Homotetramers consisting of a proteolytically cleaved form of the protein, or type A subunit, exhibit low affinity for heparin and do not interact with the ECM. A mutation in this gene may be associated with increased heart disease risk. [provided by RefSeq, Oct 2015]'
• Protein Families: Druggable Genome, Secreted Protein