Glutamine Synthetase (GLUL) (NM_002065) Human Mass Spec Standard
CAT#: PH304161
GLUL MS Standard C13 and N15-labeled recombinant protein (NP_002056)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204161 |
| Predicted MW | 42.1 kDa |
| Protein Sequence |
>RC204161 protein sequence
Red=Cloning site Green=Tags(s) MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS VTEALIRTCLLNETGDEPFQYKN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002056 |
| RefSeq Size | 4737 |
| RefSeq ORF | 1119 |
| Synonyms | GLNS; GS; PIG43; PIG59 |
| Locus ID | 2752 |
| UniProt ID | P15104, A8YXX4 |
| Cytogenetics | 1q25.3 |
| Summary | 'The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]' |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400756 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422348 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422357 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425547 | GLUL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400756 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
USD 436.00 |
|
| LY422348 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 |
USD 436.00 |
|
| LY422357 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3 |
USD 436.00 |
|
| LY425547 | Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 |
USD 396.00 |
|
| PH304039 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028228) |
USD 2,055.00 |
|
| PH304238 | GLUL MS Standard C13 and N15-labeled recombinant protein (NP_001028216) |
USD 2,055.00 |
|
| TP304039 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3 |
USD 823.00 |
|
| TP304161 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
USD 823.00 |
|
| TP304238 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2 |
USD 823.00 |
|
| TP720579 | Recombinant protein of human glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1 |
USD 330.00 |
|
| TP750165 | Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 1, full length, with C-terminal His tag, expressed in E.coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China