SH2D2A (NM_003975) Human Mass Spec Standard

CAT#: PH304162

SH2D2A MS Standard C13 and N15-labeled recombinant protein (NP_003966)

Product Images

Coomassie blue staining of purified SH2D2A protein (Cat# TP304162). The protein was produced from HEK293T cells transfected with SH2D2A cDNA clone (Cat# RC204162) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204162
• Predicted MW: 42.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204162 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASSTGNAERAEEVPGEGSLFL
  QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH
  FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ
  DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY
  NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
  GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003966
• RefSeq Size: 1661
• RefSeq ORF: 1167
• Synonyms: F2771; SCAP; TSAD; VRAP
• Locus ID: 9047
• UniProt ID: Q9NP31
• Cytogenetics: 1q23.1
• Summary: This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
• Protein Pathways: VEGF signaling pathway