PEDF (SERPINF1) (NM_002615) Human Mass Spec Standard

CAT#: PH304186

SERPINF1 MS Standard C13 and N15-labeled recombinant protein (NP_002606)

Product Images

Coomassie blue staining of purified SERPINF1 protein (Cat# TP304186). The protein was produced from HEK293T cells transfected with SERPINF1 cDNA clone (Cat# RC204186) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204186
• Predicted MW: 46.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204186 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRS
  SMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTARQKNLKSAS
  RIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGV
  AHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPL
  KVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKP
  IKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002606
• RefSeq Size: 1552
• RefSeq ORF: 1254
• Synonyms: EPC-1; OI6; OI12; PEDF; PIG35
• Locus ID: 5176
• UniProt ID: P36955, A0A140VKF3
• Cytogenetics: 17p13.3
• Summary: 'This gene encodes a member of the serpin family that does not display the serine protease inhibitory activity shown by many of the other serpin proteins. The encoded protein is secreted and strongly inhibits angiogenesis. In addition, this protein is a neurotrophic factor involved in neuronal differentiation in retinoblastoma cells. Mutations in this gene were found in individuals with osteogenesis imperfecta, type VI. [provided by RefSeq, Aug 2016]'
• Protein Families: Druggable Genome, Secreted Protein