HAUS1 (NM_138443) Human Mass Spec Standard

CAT#: PH304226

HAUS1 MS Standard C13 and N15-labeled recombinant protein (NP_612452)

Product Images

Coomassie blue staining of purified HAUS1 protein (Cat# TP304226). The protein was produced from HEK293T cells transfected with HAUS1 cDNA clone (Cat# RC204226) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204226
• Predicted MW: 31.9 kDa
• Protein Sequence:
  Sequence Link

  >RC204226 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAK
  YLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIEL
  EKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDA
  SLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612452
• RefSeq Size: 1145
• RefSeq ORF: 834
• Synonyms: CCDC5; HEI-C; HEIC; HsT1461
• Locus ID: 115106
• UniProt ID: Q96CS2
• Cytogenetics: 18q21.1
• Summary: HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]). [supplied by OMIM, Jun 2010]
• Protein Families: Stem cell - Pluripotency