SEPT6 (NM_145802) Human Mass Spec Standard
CAT#: PH304244
SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665801)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204244 |
Predicted MW | 49.2 kDa |
Protein Sequence |
>RC204244 protein sequence
Red=Cloning site Green=Tags(s) MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK RDKEKKNFF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_665801 |
RefSeq Size | 2564 |
RefSeq ORF | 1287 |
Synonyms | SEP2; SEPT2; SEPT6 |
Locus ID | 23157 |
UniProt ID | Q14141, Q548C9 |
Cytogenetics | Xq24 |
Summary | This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402410 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407883 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407884 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407885 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430147 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402410 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant II |
USD 396.00 |
|
LY407883 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant I |
USD 396.00 |
|
LY407884 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant III |
USD 396.00 |
|
LY407885 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant V |
USD 396.00 |
|
LY430147 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant V |
USD 396.00 |
|
PH306957 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_055944) |
USD 2,055.00 |
|
PH309634 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665798) |
USD 2,055.00 |
|
PH318686 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665799) |
USD 2,055.00 |
|
TP304244 | Recombinant protein of human septin 6 (SEPT6), transcript variant V |
USD 823.00 |
|
TP306957 | Recombinant protein of human septin 6 (SEPT6), transcript variant II |
USD 823.00 |
|
TP309634 | Recombinant protein of human septin 6 (SEPT6), transcript variant I |
USD 823.00 |
|
TP318686 | Recombinant protein of human septin 6 (SEPT6), transcript variant III |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review