MMAB (NM_052845) Human Mass Spec Standard

CAT#: PH304290

MMAB MS Standard C13 and N15-labeled recombinant protein (NP_443077)

Product Images

Coomassie blue staining of purified MMAB protein (Cat# TP304290). The protein was produced from HEK293T cells transfected with MMAB cDNA clone (Cat# RC204290) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204290
• Predicted MW: 27.4 kDa
• Protein Sequence:
  Sequence Link

  >RC204290 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSST
  FTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHL
  KYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVA
  KFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443077
• RefSeq Size: 4154
• RefSeq ORF: 750
• Synonyms: ATR; cblB; CFAP23; cob
• Locus ID: 326625
• UniProt ID: Q96EY8
• Cytogenetics: 12q24.11
• Summary: This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found. [provided by RefSeq, Apr 2011]
• Protein Pathways: Metabolic pathways, Porphyrin and chlorophyll metabolism