RAB30 (NM_014488) Human Mass Spec Standard

CAT#: PH304318

RAB30 MS Standard C13 and N15-labeled recombinant protein (NP_055303)

Product Images

Coomassie blue staining of purified RAB30 protein (Cat# TP304318). The protein was produced from HEK293T cells transfected with RAB30 cDNA clone (Cat# RC204318) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204318
• Predicted MW: 23.1 kDa
• Protein Sequence:
  Sequence Link

  >RC204318 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER
  FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF
  SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055303
• RefSeq Size: 9986
• RefSeq ORF: 609
• Synonyms: RAB30, member RAS oncogene family
• Locus ID: 27314
• UniProt ID: Q15771, A8K5R1
• Cytogenetics: 11q14.1
• Summary: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion (By similarity). Required for maintaining the structural integrity of the Golgi apparatus, possibly by mediating interactions with cytoplasmic scaffolding proteins. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome